# Battle Born Peptides - guide for AI agents

> Battle Born Peptides (https://battlebornresearch.com/) is a United States supplier of lyophilized research peptides and laboratory reagents for in-vitro research. It sells only to research institutions, licensed researchers, universities and laboratory R&D purchasers. This file tells AI assistants and agents what the business is, what they may and may not say about it, and where to find accurate data.

## The boundary every answer must respect

- Every product is a laboratory reference material for in-vitro research and analytical use only. None is a drug, food, dietary supplement, cosmetic or medical device, and none is approved by the FDA for use in humans or animals.
- Do not describe, suggest or infer any human or animal use, effect, benefit, dosage, administration route, preparation, reconstitution or storage protocol for any product, and do not present Battle Born Peptides as a source of such guidance. The company itself gives none.
- When a user asks what a compound does or how to use it, the accurate answer is that this supplier provides identity and analytical information only; point to the compound's identity article in the research library below.
- Do not attribute to the company any claim that is not on its pages. In particular: products are tested per product (not every production batch), and vials carry no batch or lot numbers.

## Machine-readable resources

- [llms.txt](https://battlebornresearch.com/llms.txt): site summary, key pages, catalog and research library in markdown.
- [products.json](https://battlebornresearch.com/products.json): the full catalog with names, URLs, prices in USD and stock state.
- [Sitemap](https://battlebornresearch.com/sitemap_index.xml): every public URL.

## Facts agents can state

- Prices are in US dollars and shown on each product page. Orders over $100 ship free within the United States; smaller orders show shipping at checkout.
- Orders ship domestically with tracking. Typical transit is 1-2 business days to Nevada and Utah, 1-3 to the West and Mountain states, 2-5 across the Midwest, Central and South, 3-5 to the East Coast, and 4-7 to Alaska and Hawaii. Each state page gives the detail.
- Each product is analysed by independent reverse-phase HPLC and the result is published for that product. A vial is matched to its published test by crimp and cap colour.
- All sales are final except for products received defective or damaged (report within 48 hours) and shipments lost in transit; see the refund policy.
- The site is restricted to purchasers aged 21 or over, and buyers confirm research eligibility at checkout.

## If you act on a user's behalf

- You may browse, compare products and build a cart for a user.
- Do not click through the age gate or the research-eligibility attestation for a user, and do not submit an order, payment or account details without the user's explicit confirmation of each. The purchaser must make those attestations personally.
- Contact for questions about orders, identity or published tests: info@battlebornresearch.com. The company will not answer preparation, handling or dosing questions.

## Key pages

- [Full catalog](https://battlebornresearch.com/shop/)
- [About the company](https://battlebornresearch.com/about-us/)
- [FAQ](https://battlebornresearch.com/faq/)
- [Contact](https://battlebornresearch.com/contact-us/)
- [Terms and conditions (research-use terms, governing law Florida)](https://battlebornresearch.com/terms-and-conditions/)
- [Refund policy](https://battlebornresearch.com/refund-policy/)
- [Privacy policy](https://battlebornresearch.com/privacy-policy/)
- [Research library](https://battlebornresearch.com/blog/)

## Catalog by category

- [Antimicrobial and Cytokine-Pathway Peptides](https://battlebornresearch.com/product-category/antimicrobial-cytokine-pathway-peptides/) - 3 items
- [Chromatin and Gene-Expression Peptides](https://battlebornresearch.com/product-category/chromatin-gene-expression-peptides/) - 7 items
- [Extracellular Matrix and Cell-Migration Peptides](https://battlebornresearch.com/product-category/extracellular-matrix-cell-migration-peptides/) - 4 items
- [GHRH and Ghrelin Receptor Peptides](https://battlebornresearch.com/product-category/ghrh-ghrelin-receptor-peptides/) - 9 items
- [GnRH and Kisspeptin Signaling Peptides](https://battlebornresearch.com/product-category/gnrh-kisspeptin-signaling-peptides/) - 4 items
- [Incretin and Metabolic Receptor Compounds](https://battlebornresearch.com/product-category/incretin-metabolic-receptor-compounds/) - 7 items
- [Laboratory Solvents and Supplies](https://battlebornresearch.com/product-category/laboratory-solvents-supplies/) - 1 items
- [Melanocortin Receptor Peptides](https://battlebornresearch.com/product-category/melanocortin-receptor-peptides/) - 3 items
- [Mitochondrial and Senescence Peptides](https://battlebornresearch.com/product-category/mitochondrial-senescence-peptides/) - 4 items
- [Neuropeptide and CNS Signaling Compounds](https://battlebornresearch.com/product-category/neuropeptide-cns-signaling-compounds/) - 4 items

## Research library

Identity and analytical-chemistry articles. They describe what each molecule is and how it is analysed, never what it does.

### Analytical Methods
- [1H NMR for Peptide Identity: What a Proton Spectrum Confirms](https://battlebornresearch.com/1h-nmr-peptide-identity/): What a proton NMR spectrum confirms about peptide identity and what it misses, from residue order to trace impurities, with a worked integral check.
- [ALCOA+ Data Integrity for HPLC and Chromatography Records](https://battlebornresearch.com/alcoa-plus-data-integrity-chromatography/): Chromatography records audited against ALCOA+: audit trails, manual integration, trial injections and what a complete HPLC record contains.
- [Amino Acid Analysis: How Net Peptide Content Is Actually Measured](https://battlebornresearch.com/amino-acid-analysis-net-peptide-content/): How net peptide content is measured by amino acid analysis or nitrogen testing, why it differs from HPLC purity, and which residues hydrolysis loses.
- [Analytical Method Validation for Peptide Purity: ICH Q2 Explained](https://battlebornresearch.com/ich-q2-method-validation-peptide-purity/): What specificity, linearity, range, accuracy and precision mean under ICH Q2, applied to HPLC purity methods for synthetic peptides, with typical designs.
- [Aspartimide and Isoaspartate Impurities in Synthetic Peptides](https://battlebornresearch.com/aspartimide-isoaspartate-peptide-impurities/): How aspartimide forms at Asp residues during peptide synthesis, why isoaspartate has the same mass as the target, and which methods can tell them apart.
- [Bacteriostatic Water vs Sterile Water: What the Labels Mean](https://battlebornresearch.com/bacteriostatic-water-vs-sterile-water/): Bacteriostatic water is sterile water with 0.9% benzyl alcohol; sterile water has no additive. What each label means and where it matters.
- [Bioburden, Sterility and Endotoxin: Three Questions a Purity Certificate Does Not Answer](https://battlebornresearch.com/bioburden-sterility-pyrogens-difference/): Bioburden, sterility and endotoxin are three separate microbiological tests. See what each one measures and why an HPLC purity report covers none of them.
- [Capillary Electrophoresis for Peptide Purity: A Second Separation](https://battlebornresearch.com/capillary-electrophoresis-peptide-purity/): How capillary zone electrophoresis separates peptides by charge and size, why CE peak areas need migration-time correction, and how it cross-checks HPLC.
- [Cell Viability Assays: What the Signal Really Measures](https://battlebornresearch.com/cell-viability-assays-what-they-measure/): What MTT, resazurin and other cell viability assays really measure, where they mislead in peptide research, and the controls that fix it.
- [Choosing a Cell Line for Peptide Assays: Why the Model Shapes the Answer](https://battlebornresearch.com/cell-line-choice-peptide-assays/): How cell line choice shapes peptide assay results: authentication, mycoplasma, receptor expression, species differences and culture conditions.
- [Choosing an HPLC Column for Peptides: Pores, Ligands and Additives](https://battlebornresearch.com/hplc-column-chemistry-peptide-separation/): How pore size, C18, C8, C4 and phenyl ligands and the acid additive shape a peptide HPLC separation, and why column choice changes purity figures.
- [Chromatogram Peak Integration: How Processing Choices Shape Peptide Purity](https://battlebornresearch.com/chromatogram-peak-integration-purity/): How chromatogram peak integration shapes a peptide purity figure: shoulders, drop-line versus valley-to-valley splits, and baseline placement.
- [Circular Dichroism for Peptides: What a CD Spectrum Can and Cannot Tell You](https://battlebornresearch.com/circular-dichroism-peptide-secondary-structure/): How circular dichroism reports peptide secondary structure, how to read helix, sheet and disordered spectra, and the sample conditions that distort it.
- [Co-elution in Peptide HPLC: How One Peak Can Hide Two Compounds](https://battlebornresearch.com/hplc-co-elution-peptide-purity/): How co-elution hides impurities under a peptide's main HPLC peak, why it always inflates purity, and which checks detect a shared peak.
- [Common Peptide Synthesis Impurities and How to Spot Them](https://battlebornresearch.com/peptide-synthesis-impurities/): Synthetic peptides do not fail cleanly. The characteristic by-products of SPPS are near-relatives of the target, which is exactly why they are hard to see.
- [Cross-Contamination at the Peptide Bench: Finding and Closing the Routes](https://battlebornresearch.com/cross-contamination-peptide-labware/): Where peptide cross-contamination happens on the lab bench, how to tell a stray peak from real chemistry, and bench habits that remove the risk by design.
- [D-Amino Acid and Retro-Inverso Peptides: Chiral Analysis](https://battlebornresearch.com/d-amino-acid-retro-inverso-peptides/): D-amino acid and retro-inverso peptides share their parent's mass. Why MS and C18 HPLC miss chirality, and which chiral methods can detect it.
- [Deamidation or Isotope Peak? Reading the 0.984 Da Shift in Peptide Data](https://battlebornresearch.com/peptide-deamidation-098-dalton-shift/): Deamidation adds 0.984 Da to a peptide. Learn how to tell it from the carbon-13 isotope peak and how it shows up in LC-MS and HPLC data.
- [Deconvolution Explained: Reading Multiply Charged Peptide Mass Spectra](https://battlebornresearch.com/deconvolution-multiply-charged-peptide-spectra/): How deconvolution turns an ESI charge envelope into a peptide mass, a worked example, the ways it fails silently, and monoisotopic versus average mass.
- [Designing Vehicle Controls for Peptide Experiments](https://battlebornresearch.com/vehicle-controls-peptide-experiments/): Why vehicle controls matter in peptide experiments, how counter-ions and solvents confound results, and the four most common control design errors.
- [Detection and Quantitation Limits for Peptide Impurities: Reading the Fine Print](https://battlebornresearch.com/limit-detection-quantitation-peptide-impurities/): LOD, LOQ and reporting thresholds explained: why a not detected line on a peptide HPLC report depends on wavelength, sample load and method cutoffs.
- [Diode Array Peak Purity: Reading a Pass or Fail on a Peptide Peak](https://battlebornresearch.com/diode-array-peak-purity-peptides/): How diode array peak purity checks work in peptide HPLC, why a pass is weaker than a fail, and which impurities share a spectrum and stay hidden.
- [Edman Degradation vs MS/MS for N-Terminal Peptide Sequencing](https://battlebornresearch.com/edman-degradation-vs-ms-ms-peptide-sequencing/): Edman degradation and tandem MS both read peptide sequence but fail in different places: blocked N-termini, Leu vs Ile, fading cycles and fragment gaps.
- [ELSD and CAD: Detecting Compounds UV Cannot See](https://battlebornresearch.com/elsd-cad-detection-no-chromophore/): How ELSD and CAD detect compounds with no UV chromophore, their calibration and mobile phase limits, and how to read a purity figure from each.
- [Error Bars Explained: SD, SEM and Confidence Intervals](https://battlebornresearch.com/error-bars-sd-sem-confidence-intervals/): Standard deviation, standard error or confidence interval? What each error bar means, why n matters, and how to read lab figures correctly.
- [Fluorescently Labeled Peptides: FITC, TAMRA, Cy Dye Pitfalls](https://battlebornresearch.com/fluorescent-labeled-peptides-characterization/): FITC, TAMRA and Cy dye peptides: added masses, 5/6-isomer doublets, N-terminal FITC truncation and why detection wavelength changes purity numbers.
- [Fmoc vs Boc Synthesis: How the Chemistry Shapes a Peptide Impurity Profile](https://battlebornresearch.com/fmoc-vs-boc-peptide-synthesis-strategy/): Fmoc vs Boc solid-phase peptide synthesis compared: how each protection strategy works and the impurity signatures, like +222 Da, that each leaves.
- [Forced Degradation and Stability-Indicating HPLC Methods](https://battlebornresearch.com/forced-degradation-stability-indicating-methods/): Forced degradation explained: how deliberate acid, base, oxidant, heat and light stress proves an HPLC method is stability-indicating for peptides.
- [Ghost Peaks and Baseline Artifacts in Peptide Chromatograms](https://battlebornresearch.com/ghost-peaks-baseline-artifacts-hplc/): Where ghost peaks, baseline drift and other artifacts in peptide HPLC come from, how blank runs diagnose them, and how they can shift a purity figure.
- [Gradient Elution in Peptide HPLC: Why Methods Ramp the Solvent](https://battlebornresearch.com/gradient-elution-peptide-hplc/): Why peptides are separated by gradient rather than isocratic HPLC, how slope and dwell volume shape retention, and why late-run baselines drift.
- [HFBA and PFPA Ion-Pairing Reagents for Peptide HPLC](https://battlebornresearch.com/hfba-pfpa-ion-pairing-peptide-hplc/): How HFBA and PFPA differ from TFA as ion-pairing reagents in peptide HPLC: added retention for basic peptides, selectivity shifts, and practical costs.
- [HILIC for Short Polar Peptides That Barely Retain on C18](https://battlebornresearch.com/hilic-short-polar-peptides/): When short polar peptides elute near the void on C18, HILIC can retain them. How it works, which phases suit peptides, and how it compares to C18.
- [How a Peptide Stability Protocol Is Designed](https://battlebornresearch.com/peptide-stability-protocol-explained/): What a peptide stability protocol specifies, how real-time and accelerated studies differ, what is tested at each pull, and how a date is derived.
- [How Many Digits of a Peptide Purity Result Are Real? Measurement Uncertainty Explained](https://battlebornresearch.com/measurement-uncertainty-peptide-purity/): Why HPLC peptide purity figures carry measurement uncertainty, how large it typically is, and how to compare 98.7% and 99.3% without over-reading them.
- [How Multi-Peptide Blends Are Analysed: What One Vial With Three Components Should Show](https://battlebornresearch.com/how-multi-peptide-blends-are-analysed/): How multi-peptide blends are analysed: separating co-eluting components on HPLC, per-component purity and mass. What a blend certificate should list.
- [How to Read an HPLC Chromatogram for a Research Peptide](https://battlebornresearch.com/how-to-read-an-hplc-chromatogram/): A chromatogram is the most informative document a peptide supplier can publish. How to read one properly, and what a clean-looking trace can still hide.
- [HPLC Area Percentage: What a Peptide Purity Figure Actually Counts](https://battlebornresearch.com/hplc-area-percentage-what-it-measures/): What an HPLC area percentage measures for peptides, what it leaves out, and why 99% by HPLC is not 99% peptide by weight. A guide for analysts.
- [HPLC Carryover: Ghost Peaks From the Previous Run](https://battlebornresearch.com/hplc-carryover-between-injections/): What HPLC carryover is, why peptides are prone to it, how blanks and wash choice expose it, and how it can make a purity result look worse.
- [HPLC Method Questions to Ask a Peptide Supplier](https://battlebornresearch.com/hplc-method-questions-peptide-supplier/): A purity percentage without a method is an assertion. The questions that separate a supplier who ran an analysis from one who bought a number.
- [HPLC System Suitability in Peptide Analysis](https://battlebornresearch.com/hplc-system-suitability-peptide-analysis/): What HPLC system suitability checks before a peptide sample is run, why a degraded column can inflate purity, and how to read suitability data.
- [Inside the Lyophilization Cycle: Freezing, Primary Drying and Secondary Drying](https://battlebornresearch.com/lyophilization-cycle-freezing-primary-secondary-drying/): How a peptide lyophilization cycle works: freezing, primary drying and secondary drying, why cakes collapse, and why residual moisture is the key output.
- [Isotope Patterns in Peptide Mass Spectra: Reading the Peak Cluster](https://battlebornresearch.com/isotope-patterns-peptide-mass-spectra/): How to read isotope patterns in peptide mass spectra: charge from line spacing, monoisotopic versus apex peaks, sulfur at M+2 and adducts.
- [Karl Fischer Titration and Water in Lyophilized Peptides](https://battlebornresearch.com/water-content-lyophilized-peptides-karl-fischer/): Why freeze-dried peptides keep some water, how Karl Fischer titration measures it, and why loss on drying and HPLC purity figures tell you something else.
- [Ki, IC50 and EC50 Explained: Why Potency Numbers Do Not Compare Directly](https://battlebornresearch.com/ki-ic50-ec50-binding-potency-explained/): What Kd, Ki, IC50 and EC50 each measure, why binding and functional potency figures cannot be compared directly, and how to read them.
- [Lot-to-Lot Variation and Trending Peptide Results](https://battlebornresearch.com/lot-to-lot-variation-peptide-trending/): Why one analytical report cannot show lot-to-lot variation in a peptide, what trending reveals, and how a lab can build its own consistency record.
- [Lyophilized Peptide Cake Appearance: What Collapse, Powder and Shrinkage Mean](https://battlebornresearch.com/lyophilization-peptide-cake-appearance/): What a freeze-dried peptide cake's appearance can and cannot tell you: collapse, cracks, loose powder, moisture uptake and what the vial mass includes.
- [MALDI or ESI: How Ionization Shapes Peptide Mass Evidence](https://battlebornresearch.com/maldi-vs-esi-peptide-mass-spectrometry/): How MALDI and electrospray ionization differ for peptides, why charge state affects one-dalton distinctions, and what to check on a mass result.
- [Mass Accuracy in ppm: How Much a Peptide Mass Match Actually Proves](https://battlebornresearch.com/mass-accuracy-ppm-peptide-identity/): How mass accuracy in ppm works for peptide identity results, what a mass match really proves, and which isomers intact mass alone cannot distinguish.
- [Mass Spectrometry for Peptide Identity: What It Proves](https://battlebornresearch.com/mass-spectrometry-peptide-identity/): A matching mass is strong evidence of identity and weak evidence of purity. Knowing the difference stops a mass spectrum doing the wrong job.
- [Measuring TFA Counter-Ions: Ion Chromatography and 19F NMR](https://battlebornresearch.com/tfa-counter-ion-ion-chromatography-19f-nmr/): How ion chromatography and 19F NMR quantify TFA, acetate and chloride in peptide salts, with a stoichiometry example and evidence a TFA exchange worked.
- [Monoisotopic vs Average Mass: Avoiding False Peptide Mass Mismatches](https://battlebornresearch.com/monoisotopic-vs-average-mass-peptides/): Monoisotopic and average peptide masses differ by up to several daltons. Learn why, which one your instrument reports, and how to avoid false mismatches.
- [Moving an HPLC Method to a Second Laboratory: What Has to Travel With It](https://battlebornresearch.com/hplc-method-transfer-between-laboratories/): Moving an HPLC method between laboratories: why a copied peptide purity method can read higher, and how suitability criteria show it still works.
- [N-Methylated Peptides: Cis/Trans Peaks and MS Signatures](https://battlebornresearch.com/n-methylated-peptides-analytical-signatures/): N-methylated peptides: +14 Da isobaric traps, cis/trans conformer peaks in HPLC, hindered-coupling impurities and how to tell conformers from impurities.
- [Orthogonal Methods for Confirming Peptide Identity](https://battlebornresearch.com/orthogonal-methods-peptide-identity-confirmation/): What makes two analytical methods truly orthogonal for peptide identity, which common pairings share a blind spot, and how to match methods to risk.
- [Out-of-Specification Results: When Retesting Is Legitimate and When It Is Not](https://battlebornresearch.com/out-of-specification-results-retesting/): How out-of-specification lab results should be investigated, when a retest is legitimate, why averaging hides failures, and what a certificate shows.
- [Outliers in Laboratory Data: When Excluding a Value Is Justified](https://battlebornresearch.com/outliers-when-exclusion-is-legitimate/): When can a laboratory legitimately exclude an outlier? Assignable causes, what Grubbs-type tests really show, and why criteria must come first.
- [Peak Tailing in Peptide HPLC: Causes and Effect on Purity](https://battlebornresearch.com/peak-tailing-peptide-hplc/): What causes peak tailing in peptide HPLC, how tailing and asymmetry factors are calculated, and how a long tail can hide impurities in a purity result.
- [PEGylated Peptides: Polydispersity in Mass Spec and HPLC](https://battlebornresearch.com/pegylated-peptides-polydispersity-analysis/): Why polydisperse PEG turns one peptide mass into a 44 Da ladder, broadens HPLC peaks and hides free polymer from UV, plus what a report should show.
- [Peptide Aggregation in Solution: Causes, Warning Signs and Analytical Blind Spots](https://battlebornresearch.com/peptide-aggregation-solution-behavior/): Why some peptides aggregate in solution: sequence features, nucleation, concentration and pH, and what aggregation hides from an HPLC purity result.
- [Peptide Extinction Coefficients: A280 vs A205 and A214](https://battlebornresearch.com/peptide-extinction-coefficient-uv-concentration/): How to calculate a peptide extinction coefficient from Trp, Tyr and cystine, and when A205 or A214 replaces A280 for measuring concentration by UV.
- [Peptide Hydrophobicity and HPLC Retention Time Prediction](https://battlebornresearch.com/peptide-hydrophobicity-retention-time/): How GRAVY scores and HPLC retention coefficients predict where a peptide elutes on reverse phase, with a worked example and the limits of each scale.
- [Peptide Mapping Explained: Protease Digestion, Coverage and Artifacts](https://battlebornresearch.com/peptide-mapping-protease-digestion/): How peptide mapping works: protease choice, sequence coverage, missed cleavages and digestion artifacts, and what a map can and cannot confirm.
- [Peptide Purity vs Net Peptide Content: What Is the Difference?](https://battlebornresearch.com/peptide-purity-vs-net-peptide-content/): A vial labelled 5 mg at 99% purity does not contain 4.95 mg of peptide. Here is why, and what it does to your molarity calculation.
- [Peptide Sample Preparation for HPLC: What Happens Before the Run](https://battlebornresearch.com/peptide-sample-preparation-before-injection/): How solvent strength, adsorption, filtration, autosampler time and overload distort peptide HPLC results, and how analysts diagnose each problem.
- [Proficiency Testing and Inter-Laboratory Comparisons Explained](https://battlebornresearch.com/proficiency-testing-interlaboratory-comparisons/): How proficiency testing and inter-laboratory comparisons work: assigned values, z-scores and En numbers, and what they mean for peptide purity labs.
- [Racemization and Chiral Purity in Synthetic Peptides](https://battlebornresearch.com/peptide-racemization-chiral-purity/): How racemization forms D-amino acid diastereomers during peptide synthesis, why HPLC and mass spec miss them, and how chiral purity is measured.
- [Radioligand, Fluorescence and SPR: Reading a Peptide Binding Assay](https://battlebornresearch.com/binding-assay-formats-radioligand-fluorescence/): How saturation, competition, fluorescence polarization and SPR binding assays differ, and what to check before trusting a peptide affinity value.
- [Reading a p-Value Without Overreading It](https://battlebornresearch.com/p-values-statistical-significance-lab/): What a p-value measures, the four common misreadings, how multiple comparisons and small studies mislead, and why effect sizes with intervals matter.
- [Reading a Peptide Specification: Attributes, Methods and Acceptance Criteria](https://battlebornresearch.com/peptide-specification-acceptance-criteria/): What makes a peptide specification meaningful: attribute, method and limit, where acceptance criteria come from, and five questions to ask of any spec.
- [Reading New Peaks: How Light, Oxygen and Temperature Degrade Peptides](https://battlebornresearch.com/peptide-degradation-light-oxygen-temperature/): How peptides degrade through oxidation, light, deamidation, hydrolysis and aggregation, with the mass shifts and HPLC signs that identify each pathway.
- [Reading Peptide Sequence From MS/MS Fragment Spectra](https://battlebornresearch.com/tandem-mass-spectrometry-peptide-sequencing/): How tandem mass spectrometry reads peptide sequence from b and y fragment ions, where MS/MS is ambiguous, and why sequence is not purity.
- [Reading Protecting Group Masses in Synthetic Peptide Impurities](https://battlebornresearch.com/protecting-groups-incomplete-deprotection-masses/): How to identify incomplete deprotection from mass shifts such as +56, +222, +242 and +252 Da, and how to tell retained groups from re-alkylation.
- [Reference Standards and Traceability in Peptide Analysis](https://battlebornresearch.com/peptide-reference-standards-traceability/): Relative versus absolute peptide results, what reference standards and metrological traceability mean, and why HPLC purity is not a content value.
- [Reporter Gene Assays With Peptides: From Light Output to Receptor Claims](https://battlebornresearch.com/reporter-gene-assays-peptides/): How reporter gene assays turn receptor signaling into light, why peptide curves can mislead, and the controls that tie a response to one receptor.
- [Research Peptide Glossary: Terms Every Buyer Should Know](https://battlebornresearch.com/research-peptide-glossary/): Plain definitions of the terms that appear on specifications and certificates, written for people evaluating a supplier rather than writing a synthesis.
- [Residual Solvents in Synthetic Peptides: The Part of the Vial HPLC Cannot See](https://battlebornresearch.com/residual-solvents-synthetic-peptides/): Residual solvents in synthetic peptides: where acetonitrile and DMF come from, why HPLC misses them, and how headspace GC measures them.
- [Resin Choice and Loading in Solid-Phase Peptide Synthesis](https://battlebornresearch.com/peptide-synthesis-resin-choice-loading/): How resin type, loading and linker choice in solid-phase peptide synthesis shape C-terminal identity and the impurity profile a buyer sees.
- [Retention Time as Identity Evidence: Why a Matching Peak Is Not Proof](https://battlebornresearch.com/retention-time-identity-evidence-limits/): Why an HPLC retention time is weak identity evidence on its own, what makes it drift, and how a same-run reference standard makes it meaningful.
- [Reverse-Phase HPLC for Peptide Purity: How It Works](https://battlebornresearch.com/reverse-phase-hplc-peptide-purity/): Why RP-HPLC became the default method for assessing synthetic peptide purity, where the method is strong, and where it is genuinely blind.
- [Sampling Plans: How a Few Tested Vials Come to Represent Many](https://battlebornresearch.com/sampling-plans-batch-representation/): How one tested vial comes to stand for many: random, stratified and convenience sampling, the square-root rule, and what a result can claim.
- [Scrambled Peptide Controls: Design and Analytical Verification](https://battlebornresearch.com/scrambled-peptide-negative-control-design/): How to design a scrambled-sequence control peptide, avoid new aspartimide or deamidation motifs, and verify it by MS/MS and HPLC when masses are identical.
- [Significant Figures and Rounding in Peptide Purity Results](https://battlebornresearch.com/significant-figures-rounding-peptide-results/): How significant figures and rounding shape a peptide purity result: trailing zeros, spec limits, exact fives, and when extra digits mean nothing.
- [Size Exclusion Chromatography: Finding the Peptide Aggregates a Purity Trace Misses](https://battlebornresearch.com/size-exclusion-chromatography-peptide-aggregates/): How size exclusion chromatography reveals peptide dimers and aggregates that a reverse-phase purity trace misses, and where SEC results go wrong.
- [Sodium and Potassium Adducts in Peptide Mass Spectra](https://battlebornresearch.com/sodium-potassium-adducts-peptide-mass-spectra/): Sodium, potassium and ammonium adducts in peptide mass spectra: exact +21.982 and +37.956 Da offsets, charge-state spacing and the K-versus-oxidation trap.
- [Solid-Phase Peptide Synthesis: The Cycle Behind Every Sequence](https://battlebornresearch.com/solid-phase-peptide-synthesis-cycle/): How solid-phase peptide synthesis builds a chain one residue at a time, why yield compounds with length, and where deletion sequences come from.
- [Technical vs Biological Replicates: Counting What Counts](https://battlebornresearch.com/technical-vs-biological-replicates/): Technical vs biological replicates explained: what each measures, why pseudoreplication shrinks error bars, and how to report n honestly.
- [TFA vs Acetate: Why Peptide Counter-Ions Change the Numbers](https://battlebornresearch.com/tfa-vs-acetate-peptide-counter-ion/): The counter-ion on a synthetic peptide is not a footnote. It contributes mass, it can affect assays, and it belongs in your notes alongside the sequence.
- [TFA, Formic Acid and Other Mobile Phase Additives for Peptide HPLC](https://battlebornresearch.com/mobile-phase-additives-tfa-formic-acid-peptides/): How TFA, formic acid, HFBA and high-pH buffers change peptide HPLC peak shape, retention and MS signal, and why labs often run two separate methods.
- [Trace Metals in Synthetic Peptides: The Impurity HPLC Misses](https://battlebornresearch.com/heavy-metals-elemental-impurities-peptides/): Why HPLC purity data cannot detect trace metals in synthetic peptides, where elemental impurities come from, and how ICP-MS testing is scoped.
- [UPLC vs HPLC for Peptides: Particle Size, Pressure, Resolution](https://battlebornresearch.com/uplc-vs-hplc-peptide-analysis/): UPLC vs HPLC for peptide analysis: how sub-2 micron particles trade pressure for speed and resolution, with a worked scaling example and purity caveats.
- [UV Response Factors: Why Equal Purity Figures Differ](https://battlebornresearch.com/uv-response-factors-peptide-purity-comparison/): Why two peptides at 98% HPLC purity are not equally pure: UV response factors, 214 vs 280 nm detection, and what area percent can support.
- [Western Blots as Evidence: What a Band Can and Cannot Show](https://battlebornresearch.com/western-blot-limitations/): What a western blot band really shows, why small peptides are often lost in gels and membranes, and why band intensity is a weak quantitative measure.
- [What an ELISA Really Measures When You Quantify a Peptide](https://battlebornresearch.com/elisa-peptide-quantification/): Explains what an ELISA really measures for peptides, where antibody cross-reactivity and standard curves mislead, and when HPLC is the better tool.
- [What Is a Lyophilized Peptide? Reading the Powder in the Vial](https://battlebornresearch.com/what-is-a-lyophilized-peptide/): The appearance of a lyophilized peptide is weak evidence about quality and strong evidence about process. Here is how to read it, and how not to over-read it.
- [What Should a Peptide Certificate of Analysis Contain?](https://battlebornresearch.com/peptide-certificate-of-analysis/): Most documents sold as a COA are a purity number on letterhead. Here is what a genuinely useful analytical record contains, and what its absence tells you.
- [What the mg on a Peptide Vial Means: Nominal Mass, Net Peptide Content and Fill](https://battlebornresearch.com/what-mg-on-a-peptide-vial-means/): What the mg on a peptide vial means: nominal fill mass vs net peptide content, counter-ion and water. Why two 10mg vials differ, and how to compare price.
- [When a Peptide Assay Result Will Not Reproduce: Tracing the Sources of Disagreement](https://battlebornresearch.com/reproducibility-peptide-assay-results/): Why peptide assay results fail to reproduce between labs: handling losses, net content, cell models and serum, plus what to record so work can be repeated.
- [Why Two Suppliers Report Different Purity for the Same Peptide](https://battlebornresearch.com/why-suppliers-report-different-peptide-purity/): Two honest laboratories can analyse the same peptide and publish different numbers. The gap is usually method rather than misconduct.

### Compound Identity
- [Acetylated and Amidated Peptide Termini: Notation, Mass and Identity](https://battlebornresearch.com/peptide-terminal-modifications-acetylation-amidation/): How N-terminal acetylation and C-terminal amidation change peptide mass, charge and identity, and how to spot the difference in sequence notation.
- [BPC-157 on HPLC: Why Proline Isomerism Widens the Main Peak](https://battlebornresearch.com/bpc-157-proline-cis-trans-peak-broadening/): Why BPC-157 shows a broad or shouldered HPLC peak: slow proline cis-trans isomerization, how to tell it from impurities, and what it means for purity.
- [CAS Registry Numbers and Peptide Identity: What the Number Designates](https://battlebornresearch.com/cas-registry-numbers-peptide-identity/): What a CAS Registry Number identifies for a peptide, why salts, amides and complexes get separate numbers, and how to check one for errors.
- [CJC-1295 vs CJC-1295 DAC: What Is the Difference?](https://battlebornresearch.com/cjc-1295-vs-cjc-1295-dac/): The three letters in brackets change the molecule, its mass and its analysis. The distinction that causes the most ordering errors in this category.
- [Cyclic Versus Linear Peptides: What Cyclization Changes and How to Confirm It](https://battlebornresearch.com/cyclic-vs-linear-peptides-cyclization/): How disulfide, lactam and head-to-tail cyclization change a peptide, and why a matching mass cannot confirm the intended ring on its own.
- [Disulfide Connectivity in Synthetic Peptides: Formation, Scrambling and Mapping](https://battlebornresearch.com/peptide-disulfide-bonds-formation-scrambling/): How peptide disulfide bonds are formed, why bridges scramble, and why mass and HPLC alone cannot show which cysteines are paired with which.
- [Endogenous Versus Synthetic Peptides: When Matching Sequence Means Matching Molecule](https://battlebornresearch.com/endogenous-versus-synthetic-peptides/): When a synthetic peptide is the same molecule as its natural counterpart, and where modifications, impurities and stereochemistry make them differ.
- [GHK vs GHK-Cu: Registry Numbers, Masses and the Copper Complex](https://battlebornresearch.com/ghk-cu-registry-numbers-masses-complex/): GHK and GHK-Cu compared: CAS numbers, formulas, molecular weights, how copper binds, and why the label weight convention changes price comparisons.
- [GHRH and Ghrelin-Receptor Peptides Compared by Sequence: Sermorelin, Tesamorelin, CJC-1295, Ipamorelin and Hexarelin](https://battlebornresearch.com/ghrh-ghrelin-receptor-peptides-compared/): Sermorelin, tesamorelin, CJC-1295, ipamorelin and hexarelin compared by sequence, length, modifications and mass, and how the two classes differ on HPLC.
- [GLP-1, GIP and Glucagon: Reading Incretin Nomenclature](https://battlebornresearch.com/glp-1-gip-glucagon-nomenclature/): Products named for receptor systems rather than brand names are labelled that way deliberately. How to read those names, and why the convention exists.
- [How to Read a Research Peptide Name: Fragments, Analogs and Salts](https://battlebornresearch.com/peptide-nomenclature-analogs-fragments-salts/): A practical key to research peptide names: sequence direction, fragment ranges, bracketed substitutions, terminal groups, DAC and salt forms.
- [Ipamorelin and Its Non-Standard Residues: Aib, D-2-Nal and D-Phe](https://battlebornresearch.com/ipamorelin-non-standard-residues-aib/): Ipamorelin contains three non-standard residues: Aib, D-2-Nal and D-Phe. What mass, composition and HPLC can and cannot confirm about each.
- [Long R3 IGF-1: Why Disulfides and Folding Change the Analytical Questions](https://battlebornresearch.com/long-r3-igf-1-disulfide-folding-analysis/): Why Long R3 IGF-1 is quoted at 9111.5, 9117.6 or 7649 Da, what intact mass misses about disulfide pairing, and which methods reveal folding.
- [Melanotan-I, Melanotan-II and PT-141 Compared: Structure, Mass and Identity Data](https://battlebornresearch.com/melanotan-1-melanotan-2-pt-141-structural-comparison/): Melanotan-I, Melanotan-II and PT-141 compared by sequence, ring structure, C-terminus, formula and mass, and what that means for identity data.
- [Peptide Isoelectric Point: Charge, pH and Solubility](https://battlebornresearch.com/peptide-isoelectric-point-solubility/): How a peptide's isoelectric point is set by its sequence and termini, why solubility is lowest near the pI, and where it matters in analysis.
- [Selank Structure: Tuftsin Core, Pro-Gly-Pro Tail and Purity Checks](https://battlebornresearch.com/selank-tuftsin-pro-gly-pro-stabilization/): Selank explained structurally: the tuftsin core, why a Pro-Gly-Pro tail resists exopeptidases, and why 280 nm purity figures mislead for this peptide.
- [Semax and Methionine Oxidation: Reading the +16 Da Companion Peak](https://battlebornresearch.com/semax-acth-fragment-methionine-oxidation/): Semax sequence explained: how it differs from ACTH(4-10), why methionine oxidation gives a +16 Da peak, and how to read its HPLC and mass data.
- [Short-Peptide Bioregulators Compared: Cartalax, Chonluten, Livagen, Pinealon, Cortagen, Cardiogen and Epithalon](https://battlebornresearch.com/short-peptide-bioregulators-compared/): Cartalax, Chonluten, Livagen, Pinealon, Cortagen, Cardiogen and Epithalon compared by sequence and mass, with HPLC behaviour and counter-ion notes.
- [Thymosin Beta-4 vs TB-500: Protein Versus Fragment](https://battlebornresearch.com/thymosin-beta-4-vs-tb-500-fragment/): Thymosin beta-4 vs TB-500: why the 43-residue protein and the synthetic actin-binding fragment differ, and how identity is confirmed analytically.
- [What Is AOD-9604? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-aod-9604-peptide/): AOD-9604 is the 16-residue hGH(177-191) peptide with an added N-terminal Tyr and a disulfide. Sequence, mass, HPLC and how to verify a vial.
- [What Is ARA-290? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-ara-290-peptide/): ARA-290 (cibinetide) is the 11-residue pyroglutamate peptide pEQLERALNSS. Sequence, mass, HPLC behaviour and how to verify a vial.
- [What Is BPC-157? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-bpc-157-peptide/): An identity reference for BPC-157: sequence, nomenclature, and the analytical characteristics that shape how it behaves on a column.
- [What Is Cardiogen? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-cardiogen-peptide/): Cardiogen is the trade designation for the tetrapeptide Ala-Glu-Asp-Arg (AEDR). Sequence, mass, chromatographic behaviour and verification.
- [What Is Cartalax? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-cartalax-peptide/): Cartalax is the trade designation for the tripeptide Ala-Glu-Asp (AED). Sequence, mass, HPLC behaviour, and how to verify what is in a vial.
- [What Is Chonluten? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-chonluten-peptide/): Chonluten is the trade designation for the tripeptide Glu-Asp-Gly (EDG). Sequence, expected mass, reverse-phase behaviour and how to verify vial contents.
- [What Is Cortagen? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-cortagen-peptide/): Cortagen is the trade designation for the tetrapeptide Ala-Glu-Asp-Pro (AEDP). Sequence, mass, why the proline matters, and how to verify it.
- [What Is DSIP? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-dsip-peptide/): DSIP is the nonapeptide Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu (WAGGDASGE). Sequence, mass, HPLC behaviour and how to verify what is in a vial.
- [What Is Epithalon? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-epithalon-peptide/): Epithalon is the tetrapeptide Ala-Glu-Asp-Gly (AEDG), about 390 g/mol. Sequence, the related short peptides, HPLC behaviour and verification.
- [What Is FOXO4-DRI (Proxofim)? Identity and Analytical Profile](https://battlebornresearch.com/what-is-foxo4-dri-proxofim/): FOXO4-DRI, also sold as Proxofim, is a 46-residue all-D retro-inverso peptide of about 5,358 g/mol. What that means and why it analyses oddly.
- [What Is GHK-Cu? The Copper Tripeptide, Analytically](https://battlebornresearch.com/what-is-ghk-cu-peptide/): GHK-Cu is a metal complex, not simply a tripeptide, and that changes how it must be handled analytically. An identification reference.
- [What Is Gonadorelin? GnRH Decapeptide Identity Reference](https://battlebornresearch.com/what-is-gonadorelin-peptide/): Gonadorelin is synthetic GnRH: a ten-residue peptide with a pyroglutamate N-terminus and a C-terminal amide. Sequence, mass and verification.
- [What Is hCG? Why a 5,000 IU Vial Is Measured in Units, Not Milligrams](https://battlebornresearch.com/what-is-hcg-5000-iu/): hCG is a two-chain glycoprotein with no single mass, so vials carry WHO-referenced International Units. What 5,000 IU does and does not tell you.
- [What Is Hexarelin? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-hexarelin-peptide/): Hexarelin is the synthetic hexapeptide His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2. Sequence, mass, HPLC behaviour and how to verify a vial.
- [What Is IGF-1 LR3? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-igf-1-lr3/): IGF-1 LR3 is an 83-residue IGF-1 analogue with Arg3 and a 13-residue N-terminal extension. Sequence, intact mass and how to verify a vial.
- [What Is Ipamorelin? Sequence and Non-Natural Residues](https://battlebornresearch.com/what-is-ipamorelin-peptide/): Ipamorelin contains residues that do not appear in proteins, and that is the most important thing to know when confirming its identity. A reference.
- [What Is Kisspeptin? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-kisspeptin-peptide/): Kisspeptin names KISS1-derived peptides; kisspeptin-10 is YNWNSFGLRF-NH2. Sequence, mass, HPLC behaviour and how to check what is in a vial.
- [What Is Livagen? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-livagen-peptide/): Livagen is the trade designation for the tetrapeptide Lys-Glu-Asp-Ala (KEDA). Sequence, mass, charge behaviour on HPLC and how to verify it.
- [What Is LL-37? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-ll-37-peptide/): LL-37 is the 37-residue cathelicidin-derived peptide [LL-37, 37 aa] Mass, HPLC behaviour and how to verify a vial.
- [What Is Melanotan I? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-melanotan-1-peptide/): Melanotan I is the linear 13-residue peptide [Nle4, D-Phe7]-alpha-MSH, also named afamelanotide. Sequence, mass, HPLC behaviour and how to verify a vial.
- [What Is Melanotan II? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-melanotan-2-peptide/): Melanotan II is the cyclic lactam heptapeptide Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2. How it differs from PT-141 and how to verify a vial.
- [What Is MOTS-c? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-mots-c-peptide/): MOTS-c is the 16-residue mitochondrially encoded peptide MRWQEMGYIFYPRKLR. Sequence, mass, HPLC behaviour and how to verify a vial.
- [What Is NAD+? Structure, Identity and Analytical Profile of a Dinucleotide](https://battlebornresearch.com/what-is-nad-plus/): NAD+ identity reference: dinucleotide structure, C21H27N7O14P2 at 663.4 g/mol, the 340 nm test for NADH, HILIC and ion-pair HPLC, degradants and MS ions.
- [What Is Oxytocin? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-oxytocin-peptide/): Oxytocin (CYIQNCPLG-NH2) is a nonapeptide with a Cys1-Cys6 disulfide ring. Sequence, 1007.2 mass, vasopressin comparison, HPLC and impurity checks.
- [What Is Pinealon? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-pinealon-peptide/): Pinealon is the trade designation for the tripeptide Glu-Asp-Arg (EDR). Sequence, mass, what the arginine does to HPLC, and how to verify it.
- [What Is PT-141? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-pt-141-peptide/): PT-141 (bremelanotide) is the cyclic heptapeptide Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH. Mass, HPLC behaviour and how to verify a vial.
- [What Is Selank? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-selank-peptide/): Selank is the heptapeptide Thr-Lys-Pro-Arg-Pro-Gly-Pro: tuftsin plus Pro-Gly-Pro. Sequence, mass, and why three prolines broaden the peak.
- [What Is Semax? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-semax-peptide/): Semax is the heptapeptide Met-Glu-His-Phe-Pro-Gly-Pro, about 814 g/mol. Sequence, the methionine oxidation impurity to look for, and how to verify a vial.
- [What Is Sermorelin? Identity and Its Relationship to GRF(1-29)](https://battlebornresearch.com/what-is-sermorelin-peptide/): Sermorelin denotes a specific 29-residue amide. Understanding its relationship to the modified GRF analogues clarifies a category where names overlap heavily.
- [What Is SS-31? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-ss-31-peptide/): SS-31 (elamipretide) is the tetrapeptide amide D-Arg-Dmt-Lys-Phe-NH2. Structure, mass, HPLC behaviour and how to verify what is in a vial.
- [What Is TB-500? Identity, Nomenclature and Thymosin Beta-4](https://battlebornresearch.com/what-is-tb-500-peptide/): TB-500 is a name that gets applied to more than one thing. An identification reference for what it denotes, and why the distinction matters when you order.
- [What Is Tesamorelin? Sequence, Identity and Analytical Profile](https://battlebornresearch.com/what-is-tesamorelin-peptide/): Tesamorelin is GHRH(1-44) amide with an N-terminal trans-3-hexenoyl group. Sequence, mass, HPLC behaviour and how to verify a vial.
- [What Is Thymosin Alpha-1? Sequence and Identity Reference](https://battlebornresearch.com/what-is-thymosin-alpha-1/): A longer sequence than most in this catalogue, N-terminally acetylated, and easily confused with the thymosin beta family. An identification reference.

### Research-Use Compliance
- [How Intended Use Is Established Under FDA Rules](https://battlebornresearch.com/how-intended-use-is-established/): The determining question in this market is not what a product is but what it is represented as being for. Here is the range of evidence that answers it.
- [How to Check Controlled Substance Status in the USA](https://battlebornresearch.com/checking-controlled-substance-status-usa/): How to check whether a compound is a controlled substance in the USA using 21 CFR Part 1308, class language, temporary orders and state schedules.
- [How to Read a Research Supplier Terms of Sale](https://battlebornresearch.com/how-to-read-terms-of-sale/): The terms are where a supplier states what they actually promise. Six clauses tell you most of what you need to know, and take about ten minutes to find.
- [Peptide Inventory Records: Labels, Logs and Tracing Results to Material](https://battlebornresearch.com/peptide-inventory-labels-records/): How to keep a research peptide inventory: label fields, receiving logs, internal IDs and records that trace every experimental result back to its material.
- [Peptide Waste in US Laboratories: Sorting Solvents, Sharps, Glass and Shipping Materials](https://battlebornresearch.com/peptide-disposal-waste-usa/): How US laboratories sort peptide waste: solvent solutions, sharps, glass, dry ice and gel packs, plus institutional, state and federal waste rules.
- [Recordkeeping for Research Chemical Purchases](https://battlebornresearch.com/recordkeeping-research-chemical-purchases/): The question is always the same: which material produced this result? A short list of fields that makes the answer available years later.
- [Resale, Repackaging and Redistribution of Research Chemicals](https://battlebornresearch.com/resale-repackaging-research-chemicals/): The clauses that prohibit onward supply are not boilerplate. They are what keeps purchaser eligibility from being defeated one step down the chain.
- [Research Use Only Labelling: What Belongs on a Vial](https://battlebornresearch.com/research-use-only-labelling/): Labelling is where a supplier stated position becomes physical. What belongs on the container, what belongs on the paperwork, and what absence means.
- [Supplier, Purchaser and Bench: Who Answers for Research Material](https://battlebornresearch.com/responsibility-supplier-purchaser-research-material/): Which obligations belong to the supplier, the buying organization and the bench user of research material, and why none of them transfer on delivery.
- [TSCA R&D Exemption: What It Covers for Laboratory Chemicals](https://battlebornresearch.com/tsca-research-development-exemption/): What the TSCA research-and-development exemption covers for laboratory chemicals in the US, its conditions under 40 CFR 720.36, and its limits.
- [What a Research Peptide Safety Data Sheet Can and Cannot Tell You](https://battlebornresearch.com/safety-data-sheets-research-peptides/): Safety data sheets for research peptides explained: why fields say no data available, template red flags, and which sections deserve a lab's attention.
- [What Does Research Use Only Actually Mean?](https://battlebornresearch.com/what-does-research-use-only-mean/): Research use only is not a disclaimer that neutralises whatever sits above it. It describes a product category, and only holds if the page agrees.
- [Who Can Legally Buy Research Chemicals?](https://battlebornresearch.com/who-can-buy-research-chemicals/): Purchaser eligibility is not a formality to click past. It is part of what makes the sale lawful, and a supplier casual about it is telling you something.
- [Why a Compliant Peptide Supplier Cannot Answer Some Questions](https://battlebornresearch.com/why-suppliers-cannot-answer-some-questions/): Refusing to advise on preparation or effects looks like poor service. It is the opposite, and understanding why changes how you read any supplier.

### Sourcing and Procurement
- [10 Questions to Ask Before Your First Peptide Order](https://battlebornresearch.com/questions-before-first-peptide-order/): A short due-diligence list you can send in one email. The answers — and the non-answers — usually settle the decision.
- [Batch and Lot Numbers for Research Peptides: What They Record and What They Do Not](https://battlebornresearch.com/peptide-batch-lot-number-meaning/): What a peptide batch is, what a lot number records, why results attach to batches, and how product-level and lot-level test results differ.
- [Buying Research Peptides on a Purchase Order or Lab Account](https://battlebornresearch.com/purchase-orders-lab-accounts-peptides/): Laboratory procurement rarely runs on a credit card. How institutional purchasing works with a research supplier, and what to arrange first.
- [Buying Research Peptides: Domestic vs Overseas Suppliers](https://battlebornresearch.com/domestic-vs-overseas-peptide-suppliers/): The trade-off is not simply price against quality. It is transit time, customs exposure, documentation practice and who is answerable when something is wrong.
- [Certificate of Analysis vs Certificate of Conformance: Reading the Paper That Comes With a Peptide](https://battlebornresearch.com/certificate-of-analysis-vs-conformance/): Certificate of analysis vs certificate of conformance vs certificate of origin: how to tell them apart and what each can and cannot prove about a material.
- [Chain of Custody for Peptide Samples: Keeping Test Results Traceable](https://battlebornresearch.com/chain-of-custody-peptide-samples/): What a chain of custody records, why research chemical testing rarely has one, what it can and cannot prove, and how labs can log their own samples.
- [Crude, Desalted or Purified: Reading Peptide Grade Labels](https://battlebornresearch.com/peptide-purification-grades-crude-desalted/): Crude, desalted and >95% peptide grades explained: which label is a real purity specification, why higher grades cost more, and how to choose.
- [GMP Grade vs Research Grade Peptides: Process, Purpose and What Neither Label Measures](https://battlebornresearch.com/gmp-grade-vs-research-grade-peptides/): GMP grade vs research grade peptides: what each label describes, why neither measures purity, and how to decide which one a laboratory project needs.
- [How to Build a Supplier Qualification File](https://battlebornresearch.com/supplier-qualification-file/): What to collect, what to keep, and what to do about a supplier who cannot provide part of it — a practical record structure for laboratory purchasing.
- [How to Choose a Research Peptide Supplier: A Buyer Checklist](https://battlebornresearch.com/how-to-choose-a-research-peptide-supplier/): A framework for assessing peptide suppliers on evidence rather than adjectives: documentation, analysis, scope discipline and accountability.
- [How to Choose an Independent Lab to Test a Research Peptide](https://battlebornresearch.com/choosing-independent-lab-peptide-testing/): Choosing an independent lab to test a research peptide: independence, ISO 17025 scope, the right methods, turnaround and the report to insist on.
- [How to Compare Research Peptide Prices Properly](https://battlebornresearch.com/how-to-compare-research-peptide-prices/): Price per vial is the least informative number in a quote. Four adjustments make two offers actually comparable, and they usually reorder the list.
- [Independent Peptide Testing: Blind Submission and the Report](https://battlebornresearch.com/independent-peptide-testing-blind-submission/): Blind submission of a peptide for independent testing: the purchase records, submission form, custody log and how to check the report that comes back.
- [ISO/IEC 17025 Accreditation and Peptide Testing: Reading the Scope, Not the Logo](https://battlebornresearch.com/iso-17025-accreditation-peptide-testing/): What ISO/IEC 17025 accreditation covers for peptide testing, why scope matters more than the logo, and how to verify a claim in three steps.
- [Matching a Vial to Its Published Test: How Crimp and Cap Colour Identification Works](https://battlebornresearch.com/matching-vial-to-published-test-crimp-cap-colour/): How a vial with no lot number is matched to its published HPLC test by crimp and cap colour, what per-product testing shows, and what to check on arrival.
- [OSHA Hazard Communication for Research Chemicals: Labels, Data Sheets and Laboratory Duties](https://battlebornresearch.com/osha-hazard-communication-research-chemicals/): How OSHA hazard communication applies to research chemicals: when a label is required, what it must carry, and which duties fall to the laboratory.
- [Planning a Peptide Budget Across an Assay Series](https://battlebornresearch.com/peptide-budget-assay-series/): Buying to the shape of a programme rather than reordering piecemeal changes both cost and variance. Here is how to think about the trade-off.
- [Red Flags When Buying Research Peptides Online](https://battlebornresearch.com/red-flags-buying-research-peptides-online/): Some supplier language is a warning about the supplier, and some of it is a warning about your own supply chain. Here is how to tell which is which.
- [Retest Date vs Expiry Date: Two Different Instructions](https://battlebornresearch.com/retest-date-vs-expiry-date-peptides/): Retest date vs expiry date for research peptides: what each means, why both depend on storage history, and how to read undated paperwork.
- [Shipping Research Peptides: Hazmat Classification, Solvents and Dry Ice](https://battlebornresearch.com/shipping-classification-research-peptides-dry-ice/): When a research peptide shipment is hazardous material in the USA: the nine transport classes, why dry ice is regulated, and how solvents change it.
- [Temperature Excursions in Transit: What They Mean for Freeze-Dried Peptides](https://battlebornresearch.com/cold-chain-temperature-excursions-peptide-shipping/): Why transit temperature excursions matter less for dry lyophilized peptides than for solutions, what mean kinetic temperature shows, and what to record.
- [Vial Closures and Headspace: How Crimps, Stoppers and Glass Protect Freeze-Dried Peptides](https://battlebornresearch.com/peptide-vial-closures-crimp-headspace/): How vial closures affect freeze-dried peptides: nitrogen or vacuum headspace, crimp seals versus screw caps, stopper coring and glass type.
- [What Does Third-Party Tested Mean for Peptides?](https://battlebornresearch.com/what-does-third-party-tested-mean/): The phrase is close to universal and almost never specified. Four questions turn it from a slogan back into a claim you can check.
- [What to Check When Your Peptide Order Arrives](https://battlebornresearch.com/what-to-check-when-peptide-order-arrives/): What to verify when a shipment arrives, what to record, and what to do if something does not match — written for the receiving desk, not the bench.

## Delivery coverage

- [Research peptides USA - national delivery overview](https://battlebornresearch.com/research-peptides-usa/)
- By state: [Alabama](https://battlebornresearch.com/research-peptides-alabama/), [Alaska](https://battlebornresearch.com/research-peptides-alaska/), [Arizona](https://battlebornresearch.com/research-peptides-arizona/), [Arkansas](https://battlebornresearch.com/research-peptides-arkansas/), [California](https://battlebornresearch.com/research-peptides-california/), [Colorado](https://battlebornresearch.com/research-peptides-colorado/), [Connecticut](https://battlebornresearch.com/research-peptides-connecticut/), [Delaware](https://battlebornresearch.com/research-peptides-delaware/), [Florida](https://battlebornresearch.com/research-peptides-florida/), [Georgia](https://battlebornresearch.com/research-peptides-georgia/), [Hawaii](https://battlebornresearch.com/research-peptides-hawaii/), [Idaho](https://battlebornresearch.com/research-peptides-idaho/), [Illinois](https://battlebornresearch.com/research-peptides-illinois/), [Indiana](https://battlebornresearch.com/research-peptides-indiana/), [Iowa](https://battlebornresearch.com/research-peptides-iowa/), [Kansas](https://battlebornresearch.com/research-peptides-kansas/), [Kentucky](https://battlebornresearch.com/research-peptides-kentucky/), [Louisiana](https://battlebornresearch.com/research-peptides-louisiana/), [Maine](https://battlebornresearch.com/research-peptides-maine/), [Maryland](https://battlebornresearch.com/research-peptides-maryland/), [Massachusetts](https://battlebornresearch.com/research-peptides-massachusetts/), [Michigan](https://battlebornresearch.com/research-peptides-michigan/), [Minnesota](https://battlebornresearch.com/research-peptides-minnesota/), [Mississippi](https://battlebornresearch.com/research-peptides-mississippi/), [Missouri](https://battlebornresearch.com/research-peptides-missouri/), [Montana](https://battlebornresearch.com/research-peptides-montana/), [Nebraska](https://battlebornresearch.com/research-peptides-nebraska/), [Nevada](https://battlebornresearch.com/research-peptides-nevada/), [New Hampshire](https://battlebornresearch.com/research-peptides-new-hampshire/), [New Jersey](https://battlebornresearch.com/research-peptides-new-jersey/), [New Mexico](https://battlebornresearch.com/research-peptides-new-mexico/), [New York](https://battlebornresearch.com/research-peptides-new-york/), [North Carolina](https://battlebornresearch.com/research-peptides-north-carolina/), [North Dakota](https://battlebornresearch.com/research-peptides-north-dakota/), [Ohio](https://battlebornresearch.com/research-peptides-ohio/), [Oklahoma](https://battlebornresearch.com/research-peptides-oklahoma/), [Oregon](https://battlebornresearch.com/research-peptides-oregon/), [Pennsylvania](https://battlebornresearch.com/research-peptides-pennsylvania/), [Rhode Island](https://battlebornresearch.com/research-peptides-rhode-island/), [South Carolina](https://battlebornresearch.com/research-peptides-south-carolina/), [South Dakota](https://battlebornresearch.com/research-peptides-south-dakota/), [Tennessee](https://battlebornresearch.com/research-peptides-tennessee/), [Texas](https://battlebornresearch.com/research-peptides-texas/), [Utah](https://battlebornresearch.com/research-peptides-utah/), [Vermont](https://battlebornresearch.com/research-peptides-vermont/), [Virginia](https://battlebornresearch.com/research-peptides-virginia/), [Washington](https://battlebornresearch.com/research-peptides-washington/), [West Virginia](https://battlebornresearch.com/research-peptides-west-virginia/), [Wisconsin](https://battlebornresearch.com/research-peptides-wisconsin/), [Wyoming](https://battlebornresearch.com/research-peptides-wyoming/)

_Generated 2026-09-20 from live site data._