Category: Compound Identity

Melanotan II is the cyclic lactam heptapeptide Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2. How it differs from PT-141 and how to verify a vial.

Melanotan I is the linear 13-residue peptide [Nle4, D-Phe7]-alpha-MSH, also named afamelanotide. Sequence, mass, HPLC behaviour and how to verify a vial.

PT-141 (bremelanotide) is the cyclic heptapeptide Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-OH. Mass, HPLC behaviour and how to verify a vial.

AOD-9604 is the 16-residue hGH(177-191) peptide with an added N-terminal Tyr and a disulfide. Sequence, mass, HPLC and how to verify a vial.

IGF-1 LR3 is an 83-residue IGF-1 analogue with Arg3 and a 13-residue N-terminal extension. Sequence, intact mass and how to verify a vial.

DSIP is the nonapeptide Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu (WAGGDASGE). Sequence, mass, HPLC behaviour and how to verify what is in a vial.

Tesamorelin is GHRH(1-44) amide with an N-terminal trans-3-hexenoyl group. Sequence, mass, HPLC behaviour and how to verify a vial.

LL-37 is the 37-residue cathelicidin-derived peptide [LL-37, 37 aa] Mass, HPLC behaviour and how to verify a vial.

Hexarelin is the synthetic hexapeptide His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2. Sequence, mass, HPLC behaviour and how to verify a vial.

SS-31 (elamipretide) is the tetrapeptide amide D-Arg-Dmt-Lys-Phe-NH2. Structure, mass, HPLC behaviour and how to verify what is in a vial.