What Tesamorelin is
Tesamorelin is the full 44-residue sequence of human growth hormone-releasing hormone, GHRH(1-44) amide, carrying one synthetic addition: a trans-3-hexenoyl group acylated onto the alpha-amine of the N-terminal tyrosine. That six-carbon acyl chain, with a single carbon-carbon double bond in the trans configuration, turns the free N-terminus into an amide. Apart from the cap, every residue in the chain is a standard L-amino acid in its native position.
The cap is the whole point of the name. Remove it and the molecule becomes plain GHRH(1-44) amide, about 96 Da lighter; truncate the chain at residue 29 and you are in Sermorelin territory, which has neither the cap nor the last 15 residues. Tesamorelin is a nonproprietary name, so the structure with its hexenoyl group, not the label, is what identifies the material.
Tesamorelin 5mg specification
| Catalog name | Tesamorelin |
|---|---|
| Sequence | (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 |
| Molecular formula | C221H366N72O67S |
| Average molecular mass | approx. 5135.9 g/mol |
| CAS number | 218949-48-5 |
| Amount per vial | 5 mg |
| Form | Lyophilized powder, sealed vial |
| HPLC purity | ≥98% |
| Shelf life | 36 months in the sealed vial |
How Tesamorelin is analyzed
The hexenoyl group leaves several fingerprints. It adds hydrophobic character at the N-terminus, so Tesamorelin elutes later than the uncapped chain would under the same gradient. Material in which acylation failed shows up as a species about 96 Da light, and a cis double bond in place of the trans one is an isomer of identical mass that only chromatography can separate. Because the N-terminal amine is acylated, the molecule also has one fewer protonation site than uncapped GHRH, a small but real difference in its charge behavior. The only sulfur in the formula is methionine 27, whose sulfoxide appears 16 Da heavy.
Two tyrosines and one phenylalanine, with no tryptophan, give only modest 280 nm absorbance, so purity is integrated at roughly 214 nm. The independent reverse-phase HPLC result for Tesamorelin 5mg is posted on this page. Nothing on the vial names a lot or batch; instead the crimp and cap color points to the posted result that vial belongs to.
Research contexts for Tesamorelin
- Studies of N-terminal acylation and its effect on peptide retention and charge
- GHRH receptor binding assays comparing acylated and non-acylated GHRH(1-44)
- Separation of cis/trans acyl isomers and des-acyl species by reverse-phase HPLC
- Aminopeptidase resistance comparisons of capped and uncapped chains in cell-free systems
Tesamorelin 5mg is supplied for laboratory work in vitro and is not for application to people or animals.
Tesamorelin questions
What is the trans-3-hexenoyl group on Tesamorelin?
A six-carbon acyl chain with a trans double bond between carbons 3 and 4, joined by an amide bond to the N-terminal tyrosine. It is the only non-amino-acid component of the molecule.
How much mass does the hexenoyl cap add?
About 96 Da relative to unmodified GHRH(1-44) amide. A deconvoluted mass that far below 5136 indicates the uncapped peptide.
Is Tesamorelin the same as Sermorelin?
No. Sermorelin is GHRH(1-29) amide with a free N-terminus, around 3358 g/mol. Tesamorelin has 15 more residues and the hexenoyl cap.
Buying Tesamorelin 5mg in the USA
Tesamorelin 5mg ships from a US warehouse with tracking included, and orders totaling over $100 ship free. Groups that need several vials for an acylation or binding comparison can ask for bulk pricing. Tesamorelin 5mg is sold exclusively to research institutions, licensed researchers, universities and laboratory R&D purchasers. For the full sequence and what an analysis should include, see What Is Tesamorelin? Sequence, Identity and Analytical Profile.
Tesamorelin 5mg is an in-vitro research compound only, not for human or veterinary use, and we offer no preparation or dosing guidance for it.


Reviews
There are no reviews yet.